HPA007484

ILF2 antibody from Sigma-Aldrich
NF45
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007484
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007484, RRID:AB_1079137
Product name
Anti-ILF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007484
Antibody type
Polyclonal
Antigen
Interleukin enhancer-binding factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLA
PNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIE
EVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAV
AALGNKVVESLRAQDPSEVLTMLTNETGFEISSSD
ATV
Storage
-20C
Provider Type Product Number
- No reagents -