HPA023189

NISCH antibody from Sigma-Aldrich
I-1, IRAS, KIAA0975
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023189
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023189, RRID:AB_1854495
Product name
Anti-NISCH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023189
Antibody type
Polyclonal
Antigen
Nischarin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AHFLHFHFYEINGITAALAEELFEKGEQLLGAGEV
FAIGPLQLYAVTEQLQQGKPTCASGDAKTDLGHIL
DFTCRLKYLKVSGTEGPFGTSNIQEQLLPFDLSIF
KSLHQVEISHCDAKHIRGLVASKPTLATLSVRFSA
TSMKEV
Storage
-20C
Provider Type Product Number
- No reagents -