HPA015890

TSNARE1 antibody from Sigma-Aldrich
FLJ31164
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015890
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015890, RRID:AB_1858402
Product name
Anti-TSNARE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015890
Antibody type
Polyclonal
Antigen
t-SNARE domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RCVGKDGEGDLGPAGTPIVPRARKRGPGVAPEGSR
MPEPTSSPTIGPRKDSAAGPHGRMAGPSTTRAKKR
KPNFCPQETEVLVSKVSKHHQLLFGTGLLKAEPTR
RYRVWSRILQAVNALGYCRRDVVDLKH
Storage
-20C
Provider Type Product Number
- No reagents -