HPA004873

MCM4 antibody from Sigma-Aldrich
CDC21, CDC54, hCdc21, MGC33310, P1-Cdc21
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004873
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004873, RRID:AB_1079337
Product name
Anti-MCM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004873
Antibody type
Polyclonal
Antigen
DNA replication licensing factor MCM4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVALY
YQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEE
ASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRL
AEAHAKVRLSNKVEAIDVEEAKRLHREALKQSAT
Storage
-20C
Provider Type Product Number
- No reagents -