Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309927 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Bromodomain Containing 7 (BRD7) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-BRD7 antibody: synthetic peptide directed towards the C terminal of human BRD7
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNF
VDLTE DTEEPKKTDV- Vial size
- 50 µg
Submitted references BRD7, a novel bromodomain gene, inhibits G1-S progression by transcriptionally regulating some important molecules involved in ras/MEK/ERK and Rb/E2F pathways.
Yersinia YopJ inhibits pro-inflammatory molecule expression in human bronchial epithelial cells.
Zhou J, Ma J, Zhang BC, Li XL, Shen SR, Zhu SG, Xiong W, Liu HY, Huang H, Zhou M, Li GY
Journal of cellular physiology 2004 Jul;200(1):89-98
Journal of cellular physiology 2004 Jul;200(1):89-98
Yersinia YopJ inhibits pro-inflammatory molecule expression in human bronchial epithelial cells.
Zhou L, Tan A, Hershenson MB
Respiratory physiology & neurobiology 2004 Apr 20;140(1):89-97
Respiratory physiology & neurobiology 2004 Apr 20;140(1):89-97
No comments: Submit comment
No validations: Submit validation data