Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00116113-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00116113-M01, RRID:AB_1204371
- Product name
- FOXP4 monoclonal antibody (M01), clone 3B12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FOXP4.
- Antigen sequence
LNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGS
SSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLG
APNPSASGPPEDRDLEEELPGEEL- Isotype
- IgG
- Antibody clone number
- 3B12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Convergent repression of Foxp2 3'UTR by miR-9 and miR-132 in embryonic mouse neocortex: implications for radial migration of neurons.
Clovis YM, Enard W, Marinaro F, Huttner WB, De Pietri Tonelli D
Development (Cambridge, England) 2012 Sep;139(18):3332-42
Development (Cambridge, England) 2012 Sep;139(18):3332-42
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FOXP4 expression in transfected 293T cell line by FOXP4 monoclonal antibody (M01), clone 3B12.Lane 1: FOXP4 transfected lysate(73.2 KDa).Lane 2: Non-transfected lysate.