HPA007176

FOXP4 antibody from Sigma-Aldrich
FLJ40908
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007176
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007176, RRID:AB_1078911
Product name
Anti-FOXP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007176
Antibody type
Polyclonal
Antigen
Forkhead box protein P4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPTLVKNMISGLSYGALNASYQAALAESSFPLLNS
PGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSP
PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPN
PSASGPPEDRDLEEELPGE
Storage
-20C
Provider Type Product Number
- No reagents -