HPA023255

THEM6 antibody from Sigma-Aldrich
C8orf55, DSCD75
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023255
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023255, RRID:AB_1845782
Product name
Anti-C8orf55 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023255
Antibody type
Polyclonal
Antigen
UPF0670 protein C8orf55 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLGWDDRAFYLEARFVSLRDGFVCALLRFRQHLLG
TSPERVVQHLCQRRVEPPELPADLQHWISYNEASS
QLLRMESGLSDVTKDQ
Storage
-20C
Provider Type Product Number
- No reagents -