WH0054455M2

FBXO42 antibody from Sigma-Aldrich
Fbx42, KIAA1332
ELISA
Recommended by provider

Antibody data

Product number
WH0054455M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0054455M2, RRID:AB_2104551
Product name
Monoclonal Anti-FBXO42 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0054455M2
Antibody type
Monoclonal
Antigen
FBXO42 (NP_061867, a.a. 619-718) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
RRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKD
TKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGEL
IIFGGLMDKKQNVKYYPKTNALYFVRAKR* (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -