HPA025071

FBXO42 antibody from Atlas Antibodies
Fbx42, KIAA1332
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA025071
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA025071, RRID:AB_1848461
Product name
Anti-FBXO42
Provider product page
Atlas Antibodies - HPA025071
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQM
YVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTV
VQGRGELIIFGGLMDKKQNVKY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -