HPA025071

FBXO42 antibody from Sigma-Aldrich
Fbx42, KIAA1332
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025071
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025071, RRID:AB_1848461
Product name
Anti-FBXO42 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025071
Antibody type
Polyclonal
Antigen
F-box only protein 42 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQM
YVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTV
VQGRGELIIFGGLMDKKQNVKY
Storage
-20C
Provider Type Product Number
- No reagents -