Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005324-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005324-M02, RRID:AB_530179
- Product name
- PLAG1 monoclonal antibody (M02), clone 3B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PLAG1.
- Antigen sequence
ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPC
QLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTK
AFVSKYKLQRHMATHSPEKTHKCNYCEK- Isotype
- IgG
- Antibody clone number
- 3B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references miRNA deregulation by epigenetic silencing disrupts suppression of the oncogene PLAG1 in chronic lymphocytic leukemia.
Pallasch CP, Patz M, Park YJ, Hagist S, Eggle D, Claus R, Debey-Pascher S, Schulz A, Frenzel LP, Claasen J, Kutsch N, Krause G, Mayr C, Rosenwald A, Plass C, Schultze JL, Hallek M, Wendtner CM
Blood 2009 Oct 8;114(15):3255-64
Blood 2009 Oct 8;114(15):3255-64
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PLAG1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol