HPA005462

PLAG1 antibody from Sigma-Aldrich
ZNF912
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005462
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005462, RRID:AB_1855447
Product name
Anti-PLAG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005462
Antibody type
Polyclonal
Antigen
Zinc finger protein PLAG1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLN
TPALDFSQLFNFIPLNGPPYNPLSVGSLGMSYSQE
EAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSAAF
TSSLSTSTTLPRFHQA
Storage
-20C
Provider Type Product Number
- No reagents -