HPA006099

PRSS57 antibody from Sigma-Aldrich
PRSSL1, UNQ782
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006099
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006099, RRID:AB_2284508
Product name
Anti-PRSSL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006099
Antibody type
Polyclonal
Antigen
Serine protease 1-like protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGLGLRGWGRPLLTVATALMLPVKPPAGSWGAQII
GGHEVTPHSRPYMASVRFGGQHHCGGFLLRARWVV
SAAHCFSHRDLRTGLVVLGAHVLSTAEPTQQVFGI
DALTTHPDYHPMTH
Storage
-20C
Provider Type Product Number
- No reagents -