ABIN632030

antibody from antibodies-online

Targeting: CYP11B2 ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo

Western blot

Antibody data

Submit

Validation data

Product number: ABIN632030 - Provider product page
Provider: antibodies-online
Product name: anti-Cytochrome P450, Family 11, Subfamily B, Polypeptide 2 (CYP11B2) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: CYP11 B2 antibody was raised using the middle region of CYP11 2 corresponding to a region with amino acids RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

CYP11B2 protein structure - ABIN632030 shown in red.