HPA018797

CHKB antibody from Atlas Antibodies
CHETK, CHKL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018797
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018797, RRID:AB_1846666
Product name
Anti-CHKB
Provider product page
Atlas Antibodies - HPA018797
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHY
LAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHF
FWGLWS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -