HPA008246

MUC5B antibody from Atlas Antibodies
MG1, MUC5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008246
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008246, RRID:AB_1854203
Product name
Anti-MUC5B
Provider product page
Atlas Antibodies - HPA008246
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNG
TIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALP
VSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFEN
LRQRGYQVCPVLA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -