HPA008246

MUC5B antibody from Sigma-Aldrich
MG1, MUC5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008246
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008246, RRID:AB_1854203
Product name
Anti-MUC5B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008246
Antibody type
Polyclonal
Antigen
Mucin-5B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNG
TIIRKAVACPGTPATTPFTFTTAWVPHSTTSPALP
VSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFEN
LRQRGYQVCPVLA
Storage
-20C
Provider Type Product Number
- No reagents -