Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023683-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023683-M01, RRID:AB_464129
- Product name
- PRKD3 monoclonal antibody (M01), clone 4G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PRKD3.
- Antigen sequence
MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTG
LSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTR
ESVTIEAQELSLSAVKDLVCSIVYQKFPEC- Isotype
- IgG
- Antibody clone number
- 4G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Pharmacologic reversion of epigenetic silencing of the PRKD1 promoter blocks breast tumor cell invasion and metastasis.
Borges S, Döppler H, Perez EA, Andorfer CA, Sun Z, Anastasiadis PZ, Thompson E, Geiger XJ, Storz P
Breast cancer research : BCR 2013 Aug 23;15(2):R66
Breast cancer research : BCR 2013 Aug 23;15(2):R66
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PRKD3 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol