Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004585-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004585-M07, RRID:AB_530137
- Product name
- MUC4 monoclonal antibody (M07), clone 5B12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MUC4.
- Antigen sequence
GVSLFPYGADAGDLEFVRRTVDFTSPLFKPATGFP
LGSSLRDSLYFTDNGQIIFPESDYQIFSYPNPLPT
GFTGRDPVALVAPFWDDADFSTGRGTTFYQEYETF
YGEHS- Isotype
- IgG
- Antibody clone number
- 5B12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression of MUC1 and MUC4 in gallbladder adenocarcinoma.
Establishment and characterization of a new human pancreatic adenocarcinoma cell line with high metastatic potential to the lung.
Identification of a novel type of CA19-9 carrier in human bile and sera of cancer patients: an implication of the involvement in nonsecretory exocytosis.
Isolation and identification of potential urinary microparticle biomarkers of bladder cancer.
Kim SM, Oh SJ, Hur B
Korean journal of pathology 2012 Oct;46(5):429-35
Korean journal of pathology 2012 Oct;46(5):429-35
Establishment and characterization of a new human pancreatic adenocarcinoma cell line with high metastatic potential to the lung.
Kalinina T, Güngör C, Thieltges S, Möller-Krull M, Penas EM, Wicklein D, Streichert T, Schumacher U, Kalinin V, Simon R, Otto B, Dierlamm J, Schwarzenbach H, Effenberger KE, Bockhorn M, Izbicki JR, Yekebas EF
BMC cancer 2010 Jun 16;10:295
BMC cancer 2010 Jun 16;10:295
Identification of a novel type of CA19-9 carrier in human bile and sera of cancer patients: an implication of the involvement in nonsecretory exocytosis.
Uozumi N, Gao C, Yoshioka T, Nakano M, Moriwaki K, Nakagawa T, Masuda T, Tanabe M, Miyoshi E
Journal of proteome research 2010 Dec 3;9(12):6345-53
Journal of proteome research 2010 Dec 3;9(12):6345-53
Isolation and identification of potential urinary microparticle biomarkers of bladder cancer.
Smalley DM, Sheman NE, Nelson K, Theodorescu D
Journal of proteome research 2008 May;7(5):2088-96
Journal of proteome research 2008 May;7(5):2088-96
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MUC4 monoclonal antibody (M07), clone 5B12 Western Blot analysis of MUC4 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MUC4 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to MUC4 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol