Antibody data

Product number
H00003984-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003984-M02A, RRID:AB_1576810
Product name
LIMK1 monoclonal antibody (M02A), clone 1B2
Provider product page
Abnova Corporation - H00003984-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant LIMK1.
Antigen sequence
ADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPI
TVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPL
GPQLEQLDRGFWETYRRGESGLPAHPEVPD
Isotype
IgG
Antibody clone number
1B2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -