HPA028064

LIMK1 antibody from Sigma-Aldrich
LIMK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028064
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028064, RRID:AB_10600111
Product name
Anti-LIMK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028064
Antibody type
Polyclonal
Antigen
LIM domain kinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDP
EKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDR
GFWETYRRGESGLPAHPEV
Storage
-20C
Provider Type Product Number
- No reagents -