H00009429-M01

ABCG2 antibody from Abnova Corporation
ABCP, BCRP, CD338, EST157481, MXR

Antibody data

Product number
H00009429-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009429-M01, RRID:AB_1570822
Product name
ABCG2 monoclonal antibody (M01), clone 1G1
Provider product page
Abnova Corporation - H00009429-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ABCG2.
Antigen sequence
EKNERINRVIQELGLDKVADSKVGTQFIRGVSGGE
RKRTSIGMELITDPSILFLDEPTTGLDSSTANAVL
LLLKRMSKQGRTIIFSIHQPRYSIFKLFDSLTLLA
SGRLM
Isotype
IgG
Antibody clone number
1G1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -