Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- NBP1-79720 - Provider product page
- Provider
- Novus Biologicals
- Proper citation
- Novus Cat#NBP1-79720, RRID:AB_11007170
- Product name
- Rabbit Polyclonal MUC3B Antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide directed towards the middle region of human MUC3BThe immunogen for this antibody is MUC3B. Peptide sequence KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA.
- Reactivity
- Human
- Host
- Rabbit
- Vial size
- 0.05 mg
- Concentration
- LYOPH
- Storage
- Store at -20°. Avoid freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- Novus Biologicals (provider)
- Main image
- Experimental details
- Western Blot: MUC3B Antibody [NBP1-79720] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.