HPA010871

MUC3A antibody from Atlas Antibodies
MUC3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010871
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010871, RRID:AB_1854201
Product name
Anti-MUC3A
Provider product page
Atlas Antibodies - HPA010871
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PCPGTITITIVPASPTDPCVEMDPSTEATSPPTTP
LTVFPFTTEMVTCPTSISIQTTLTTYMDTSSMMPE
SESSISPNASSSTGTGTVPTNTVFTSTRLPTSETW
LSNSSVIPLPLPGVSTIPLTMKPSSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -