HPA010871

MUC3A antibody from Sigma-Aldrich
MUC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010871
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010871, RRID:AB_1854201
Product name
Anti-MUC3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010871
Antibody type
Polyclonal
Antigen
Mucin-3B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCPGTITITIVPASPTDPCVEMDPSTEATSPPTTP
LTVFPFTTEMVTCPTSISIQTTLTTYMDTSSMMPE
SESSISPNASSSTGTGTVPTNTVFTSTRLPTSETW
LSNSSVIPLPLPGVSTIPLTMKPSSS
Storage
-20C
Provider Type Product Number
- No reagents -