HPA030542

EIF4H antibody from Atlas Antibodies
KIAA0038, WBSCR1, WSCR1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA030542
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA030542, RRID:AB_10601368
Product name
Anti-EIF4H
Provider product page
Atlas Antibodies - HPA030542
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRS
LRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESR
GGWDSRDDFNSG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -