HPA006411

MUC7 antibody from Sigma-Aldrich
FLJ27047, MG2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006411
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006411, RRID:AB_1854204
Product name
Anti-MUC7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006411
Antibody type
Polyclonal
Antigen
Mucin-7 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCL
HKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVV
NPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNA
TTISSRENVNTSSSVATLAPVNSPAP
Storage
-20C
Provider Type Product Number
- No reagents -