HPA023658

ZC3H3 antibody from Sigma-Aldrich
KIAA0150, ZC3HDC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023658
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023658, RRID:AB_1858973
Product name
Anti-ZC3H3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023658
Antibody type
Polyclonal
Antigen
Zinc finger CCCH domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GQLQPSRPTRARGTCSVEDPLLVCQKEPGKPRMVK
SVGSVGDSPREPRRTVSESVIAVKASFPSSALPPR
TGVALGRKLGSHSVASCAPQLLGDRRVGAGH
Storage
-20C
Provider Type Product Number
- No reagents -