HPA002899

BEGAIN antibody from Atlas Antibodies
KIAA1446
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002899
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002899, RRID:AB_1078277
Product name
Anti-BEGAIN
Provider product page
Atlas Antibodies - HPA002899
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PYPAETFRFPASPGPQQALMPPNLWSLRAKPGTAR
LPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCS
FSERYYGGAGGSPGKKADGRASPLYASYKADSFSE
GDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGY
APSE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -