HPA002899

BEGAIN antibody from Sigma-Aldrich
KIAA1446
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002899
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002899, RRID:AB_1078277
Product name
Anti-BEGIN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002899
Antibody type
Polyclonal
Antigen
Brain-enriched guanylate kinase-associated protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PYPAETFRFPASPGPQQALMPPNLWSLRAKPGTAR
LPGEDMRGQWRPLSVEDIGAYSYPVSAAGRASPCS
FSERYYGGAGGSPGKKADGRASPLYASYKADSFSE
GDDLSQGHLAEPCFLRAGGDLSLSPGRSADPLPGY
APSE
Storage
-20C
Provider Type Product Number
- No reagents -