HPA004765

NGFR antibody from Sigma-Aldrich
CD271, p75NTR, TNFRSF16
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004765
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004765, RRID:AB_1079233
Product name
Anti-NGFR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004765
Antibody type
Polyclonal
Antigen
Tumor necrosis factor receptor superfamily member 16 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLH
DQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKL
LNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRA
LLASWATQDSATLDALLAALRRIQRADLVESLCSE
S
Storage
-20C
Provider Type Product Number
- No reagents -