WH0009119M1

KRT75 antibody from Sigma-Aldrich
K6HF
ELISA
Recommended by provider

Antibody data

Product number
WH0009119M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0009119M1, RRID:AB_1842193
Product name
Monoclonal Anti-K6HF antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0009119M1
Antibody type
Monoclonal
Antigen
K6HF (NP_004684, a.a. 141-241) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
ascites fluid
Reactivity
Human
Antigen sequence
TIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNK
VLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQ
LESITTERGRLEAELRNMQDVVEDFKVRYE* (wi
thout GST)
Isotype
IgM
Storage
-20C
Provider Type Product Number
- No reagents -