Antibody data

Product number
H00009119-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009119-M10, RRID:AB_10721213
Product name
KRT75 monoclonal antibody (M10), clone 3F9
Provider product page
Abnova Corporation - H00009119-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant KRT75.
Antigen sequence
TIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNK
VLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQ
LESITTERGRLEAELRNMQDVVEDFKVRYE
Isotype
IgG
Antibody clone number
3F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -