HPA019367

KRT75 antibody from Sigma-Aldrich
K6HF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019367
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019367, RRID:AB_1852239
Product name
Anti-KRT75 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019367
Antibody type
Polyclonal
Antigen
Keratin, type II cytoskeletal 75 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSV
SVARSAAGSGGLGRISSA
Storage
-20C
Provider Type Product Number
- No reagents -