HPA019367

KRT75 antibody from Atlas Antibodies
K6HF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019367
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019367, RRID:AB_1852239
Product name
Anti-KRT75
Provider product page
Atlas Antibodies - HPA019367
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSV
SVARSAAGSGGLGRISSA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -