Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184026 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Heterogeneous Nuclear Ribonucleoprotein H3 (2H9) (HNRNPH3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HNRPH3 antibody: synthetic peptide directed towards the N terminal of human HNRPH3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRY
IEIFR SSRSEIKGFY- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Novel snail1 target proteins in human colon cancer identified by proteomic analysis.
Effect of contour shape of nervous system electromagnetic stimulation coils on the induced electrical field distribution.
Directed proteomic analysis of the human nucleolus.
Larriba MJ, Casado-Vela J, Pendás-Franco N, Peña R, García de Herreros A, Berciano MT, Lafarga M, Casal JI, Muñoz A
PloS one 2010 Apr 20;5(4):e10221
PloS one 2010 Apr 20;5(4):e10221
Effect of contour shape of nervous system electromagnetic stimulation coils on the induced electrical field distribution.
Papazov SP, Daskalov IK
Biomedical engineering online 2002 May 14;1:1
Biomedical engineering online 2002 May 14;1:1
Directed proteomic analysis of the human nucleolus.
Andersen JS, Lyon CE, Fox AH, Leung AK, Lam YW, Steen H, Mann M, Lamond AI
Current biology : CB 2002 Jan 8;12(1):1-11
Current biology : CB 2002 Jan 8;12(1):1-11
No comments: Submit comment
No validations: Submit validation data