H00152926-B01P

PPM1K antibody from Abnova Corporation
BDP, DKFZp761G058, hPTMP, PP2Ckappa, PP2Cm

Antibody data

Product number
H00152926-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00152926-B01P, RRID:AB_1578997
Product name
PPM1K purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00152926-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PPM1K protein.
Antigen sequence
MSTAALITLVRSGGNQVRRRVLLSSRLLQDDRRVT
PTCHSSTSEPRCSRFDPDGSGSPATWDNFGIWDNR
IDEPILLPPSIKYGKPIPKISLEKVGCASQIGKRK
ENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHT
HMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHA
RLSADATLLTSGTTATVALLRDGIELVVASVGDSR
AILCRKGKPMKLTIDHTPERKDEKERIKKCGGFVA
WNSLGQPHVNGRLAMTRSIGDLDLKTSGVIAEPET
KRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQ
CHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWG
KYKNSEINFSFSRSFASSGRWA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -