HPA005443

CHI3L2 antibody from Sigma-Aldrich
YKL-39, YKL39
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005443
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005443, RRID:AB_1078510
Product name
Anti-CHI3L2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005443
Antibody type
Polyclonal
Antigen
Chitinase 3-like protein 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTI
NSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTS
RLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHF
TVLIHELAEAFQKDFTKSTKER
Storage
-20C
Provider Type Product Number
- No reagents -