HPA018332

IRX6 antibody from Sigma-Aldrich
IRX-3, IRX7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018332
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018332, RRID:AB_1851920
Product name
Anti-IRX6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018332
Antibody type
Polyclonal
Antigen
Iroquois-class homeodomain protein IRX-6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEEAEDEEVVSTAGDRLTEFRKGAQSLPGPCAAAR
EGRLERRECGLAAPRFSFNDPSGSEEADFLSAETG
SPRLTMHYPCLEKPRIWSLAHTATASAVEGAPPAR
PRPRSPECRMIP
Storage
-20C
Provider Type Product Number
- No reagents -