HPA006746

TNFRSF21 antibody from Sigma-Aldrich
CD358, DR6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006746
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006746, RRID:AB_1078701
Product name
Anti-TNFRSF21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006746
Antibody type
Polyclonal
Antigen
Tumor necrosis factor receptor superfamily member 21 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAAL
TDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGT
ETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQN
LVVIKPGTKETDNVCGTLPSFSSSTS
Storage
-20C
Provider Type Product Number
- No reagents -