HPA020973

CAVIN4 antibody from Atlas Antibodies
cavin-4, MURC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020973
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020973, RRID:AB_1853079
Product name
Anti-MURC
Provider product page
Atlas Antibodies - HPA020973
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KGKDRTVAEGEECAREMGVDIIARSESLGPISELY
SDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFK
SQVKVEDDESLLL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -