HPA020973

CAVIN4 antibody from Sigma-Aldrich
cavin-4, MURC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020973
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020973, RRID:AB_1853079
Product name
Anti-MURC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020973
Antibody type
Polyclonal
Antigen
PTRF/SDPR family protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGKDRTVAEGEECAREMGVDIIARSESLGPISELY
SDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFK
SQVKVEDDESLLL
Storage
-20C
Provider Type Product Number
- No reagents -