Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB21054 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB21054, RRID:AB_10965978
- Product name
- TET1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant TET1.
- Antigen sequence
VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQIL
PLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVH
ISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPS
KSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSS
SYTT- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Epigenetic Modifications in the Biology of Nonalcoholic Fatty Liver Disease: The Role of DNA Hydroxymethylation and TET Proteins.
Pirola CJ, Scian R, Gianotti TF, Dopazo H, Rohr C, Martino JS, CastaƱo GO, Sookoian S
Medicine 2015 Sep;94(36):e1480
Medicine 2015 Sep;94(36):e1480
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle with TET1 polyclonal antibody (Cat # PAB21054) shows moderate cytoplasmic positivity in myocytes at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)