HPA019032

TET1 antibody from Sigma-Aldrich
bA119F7.1, CXXC6, KIAA1676, LCX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019032
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019032, RRID:AB_1847363
Product name
Anti-TET1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019032
Antibody type
Polyclonal
Antigen
Protein TET1 (Ten-eleven translocation 1 gene protein) (CXXC-type zinc finger protein 6) (Leukemia-associated protein with a CXXC domain)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQIL
PLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVH
ISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPS
KSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSS
SYTT
Storage
-20C
Provider Type Product Number
- No reagents -