HPA019032

TET1 antibody from Atlas Antibodies
bA119F7.1, CXXC6, KIAA1676, LCX

Antibody data

Product number
HPA019032
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019032, RRID:AB_1847363
Product name
Anti-TET1
Provider product page
Atlas Antibodies - HPA019032
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQIL
PLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVH
ISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPS
KSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSS
SYTT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.