HPA006563

antibody from Atlas Antibodies

Targeting: PRKCA PKCA, PKCα

Antibody data

Submit

Validation data

Product number: HPA006563 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA006563, RRID:AB_1079626
Product name: Anti-PRKCA
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: CVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTV RDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKT KTIRST
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PRKCA protein structure - HPA006563 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Western blot analysis in human cell lines A-549 and Caco-2 using Anti-PRKCA antibody. Corresponding PRKCA RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Orthogonal method: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Western blot analysis using Anti-PRKCA antibody HPA006563 (A) shows similar pattern to independent antibody HPA006564 (B).
Antibody #2 product nr: HPA006564
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.