HPA006563

PRKCA antibody from Atlas Antibodies
PKC?, PKCA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006563
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006563, RRID:AB_1079626
Product name
Anti-PRKCA
Provider product page
Atlas Antibodies - HPA006563
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTV
RDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKT
KTIRST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -