HPA006563

PRKCA antibody from Sigma-Aldrich
PKCA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006563
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006563, RRID:AB_1079626
Product name
Anti-PRKCA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006563
Antibody type
Polyclonal
Antigen
Protein kinase Calpha-type recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTV
RDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKT
KTIRST
Storage
-20C
Provider Type Product Number
- No reagents -