HPA006564

PRKCA antibody from Sigma-Aldrich
PKCA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006564
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006564, RRID:AB_1079625
Product name
Anti-PRKCA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006564
Antibody type
Polyclonal
Antigen
Protein kinase Calpha-type recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEG
EYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVI
SPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKV
MLADRKGTEELYAIKILKKDVV
Storage
-20C
Provider Type Product Number
- No reagents -