HPA028133

PADI1 antibody from MilliporeSigma / Merck KGaA
HPAD10, PAD1, PDI, PDI1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028133
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028133, RRID:AB_10603980
Product name
Anti-PADI1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028133
Antibody type
Polyclonal
Antigen
peptidyl arginine deiminase, type I recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKRVVQLSLKMPTHAVCVVGVEAHVDIHSDVPKGA
NSFRVSGSSGVEVFMVYNRTRVKEPIGKARWPLDT
Storage
-20C
Provider Type Product Number
- No reagents -